Product: GTS-22 (dihydrochloride)
Recombinant Human Cyclophilin-F Protein Summary
| Description |
A recombinant protein corresponding to amino acids 30 – 207 of PPIF.
Amino Acid Sequence: MGSSHHHHHHSSGLVPRGSHCSKGSGDPSSSSSSGNPLVYLDVDANGKPLGRVVLELKADVVPKTAENFRALCTGEKGFGYKGSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVKEGMDVVKKIESFGSKSGRTSKKIVITDCGQLS |
| Preparation Method |
E.coli
|
| Details of Functionality |
Specific activity is > 900 nmol/min/mg, and is defined as the amount of enzyme that cleaves 1nmole of suc-AAFP-PNA per minute at 37C in Tris-HCl pH 8.0 using chymotrypsin.
|
| Protein/Peptide Type |
Recombinant Protein
|
| Gene |
PPIF
|
| Purity |
>95% pure by SDS-PAGE
|
| Endotoxin Note |
< 1.0 EU per 1 microgram of protein (determined by LAL method)
|
Applications/Dilutions
| Application Notes |
Assay
1. Prepare 170ul assay buffer into a suitable container and pre-chill on ice before use: The final concentrations are 200 mM Tris-Hcl, pH 8.0, and 20nM chymotrypsin. 2. Add 10ul of recombinant Cyclophilin F(PPIF) protein with 1ug in assay buffer. 3. Mix by inversion and equilibrate to 1C and monitor the A405nm until the value is constant using a spectrophotometer. 4. Add 20ul pre-chilled 5mM suc-AAFP-pNA. (Substrate was dissolved in TFE that contained 460mM LiCl to a concentration of 3 mM) 5. Record the increase in A405 nm for 30 minutes at 25C. Use in immunoprecipitation, and western blot reported in scientific literature (PMID 26387735) |
|
| Theoretical MW |
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
| Publications |
|
Reactivity Notes
Mouse reactivity reported in scientific literature (PMID: 26387735)
Packaging, Storage & Formulations
| Storage |
Store at -80C. Avoid freeze-thaw cycles.
|
| Buffer |
20mM Tris pH 7.5, 1mM DTT, 10% glycerol
|
| Preservative |
No Preservative
|
| Concentration |
1.0 mg/ml
|
| Purity |
>95% pure by SDS-PAGE
|
Notes
The purity of this protein is > 95% by SDS PAGE. Molecular weight is 21 kDa (198aa), confirmed by MALDI-TOF.
Alternate Names for Recombinant Human Cyclophilin-F Protein
- Cyclophilin F
- CYP3FLJ90798
- Cyp-D
- hCyP3
- MGC117207
- mitochondrial
- peptidyl-prolyl cis-trans isomerase, mitochondrial
- peptidylprolyl isomerase F (cyclophilin F)
- peptidylprolyl isomerase F
Background
Cyclophilin F (also known as Peptidylprolyl isomerase F, PPIF) is a member of peptidyl-prolyl cis-trans isomerase family. They are highly-conserved cytoplasmic enzymes that accelerate protein folding. This protein is part of the mitochondrial permeability transition pore in the inner mitochondrial membrane. Activation of this pore is thought to be involved in the induction of apoptotic and necrotic cell death. Recombinant PPIF protein was expressed in E.coli and purified by using conventional chromatography techniques.