Recombinant Human ATF4 Protein Summary
| Description |
ATF4 (Human) GST-Tagged Recombinant Protein (P02)
Source: Wheat Germ (in vitro) Amino Acid Sequence: MTEMSFLSSEVLVGDLMSPFDQSGLGAEESLGLLDDYLEVAKHFKPHGFSSDKAKAGSSEWLAVDGLVSPSNNSKEDAFSGTDWMLEKMDLKEFDLDALLGIDDLETMPDDLLTTLDDTCDLFAPLVQETNKQPPQTVNPIGHLPESLTKPDQVAPFTFLQPLPLSPGVLSSTPDHSFSLELGSEVDITEGDRKPDYTAYVAMIPQCIKEEDTPSDNDSGICMSPESYLGSPQHSPSTRGSPNRSLPSPGVLCGSARPKPYDPPGEKMVAAKVKGEKLDKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKERADSLAKEIQYLKDLIEEVRKARGKKRVP |
| Protein/Peptide Type |
Recombinant Protein
|
| Gene |
ATF4
|
Applications/Dilutions
| Application Notes |
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.
|
Packaging, Storage & Formulations
| Storage |
Store at -80C. Avoid freeze-thaw cycles.
|
| Buffer |
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
|
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Recombinant Human ATF4 Protein
- activating transcription factor 4 (tax-responsive enhancer element B67)
- Activating transcription factor 4
- ATF4
- cAMP-dependent transcription factor ATF-4
- cAMP-responsive element-binding protein 2
- CREB-2DNA-binding protein TAXREB67
- cyclic AMP-dependent transcription factor ATF-4
- Cyclic AMP-responsive element-binding protein 2
- TAXREB67
- TAXREB67CREB2cAMP response element-binding protein 2
- Tax-responsive enhancer element-binding protein 67
- TXREB
Background
This gene encodes a transcription factor that was originally identified as a widely expressed mammalian DNA binding protein that could bind a tax-responsive enhancer element in the LTR of HTLV-1. The encoded protein was also isolated and characterized as the cAMP-response element binding protein 2 (CREB-2). The protein encoded by this gene belongs to a family of DNA-binding proteins that includes the AP-1 family of transcription factors, cAMP-response element binding proteins (CREBs) and CREB-like proteins. These transcription factors share a leucine zipper region that is involved in protein-protein interactions, located C-terminal to a stretch of basic amino acids that functions as a DNA binding domain. Two alternative transcripts encoding the same protein have been described. Two pseudogenes are located on the X chromsome at q28 in a region containing a large inverted duplication. [provided by RefSeq]