RUVBL2 Antibody Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ATVTDTTKVPEIRDVTRIERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLEMIREGKIAGR
|
| Specificity |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
|
| Predicted Species |
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
|
| Isotype |
IgG
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
RUVBL2
|
| Purity |
Affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
||
| Application Notes |
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
|
||
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
|
| Buffer |
PBS, pH 7.2, containing 40% glycerol
|
| Preservative |
0.02% Sodium Azide
|
| Purity |
Affinity purified
|
Alternate Names for RUVBL2 Antibody
- 48 kDa TATA box-binding protein-interacting protein
- 51 kDa erythrocyte cytosolic protein
- EC 3.6.1
- EC 3.6.4.12,48 kDa TBP-interacting protein
- ECP51TIP49B
- erythrocyte cytosolic protein, 51-KD
- INO80 complex subunit J
- INO80JTAP54-beta
- Repressing pontin 52
- Reptin 52
- REPTIN
- Reptin52
- RuvB (E coli homolog)-like 2
- RuvB-like 2 (E. coli)
- ruvB-like 2
- RVB2
- TBP-interacting protein, 48-KD
- TIH2
- TIP48ECP-51
- TIP49b
- TIP60-associated protein 54-beta