Product: Sitagliptin (phosphate monohydrate)
RLBP1L1 Antibody Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: TWARTLLGPDYSDENDYTHTSYNAMHVKHTSSNLERECSPKLMK
|
| Specificity |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
|
| Predicted Species |
Mouse (95%), Rat (93%). Backed by our 100% Guarantee.
|
| Isotype |
IgG
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
CLVS1
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
||
| Application Notes |
For IHC-Paraffin HIER pH6 retrieval is recommended.
|
||
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
|
| Buffer |
PBS (pH 7.2) and 40% Glycerol
|
| Preservative |
0.02% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Alternate Names for RLBP1L1 Antibody
- Cellular retinaldehyde-binding protein-like
- clavesin 1
- clavesin-1
- CRALBPLC6orf212L
- FLJ37248
- MGC34646
- retinaldehyde binding protein 1-like 1
- Retinaldehyde-binding protein 1-like 1
- RLBP1L1