RBM22 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to RBM22(RNA binding motif protein 22) The peptide sequence was selected from the C terminal of RBM22.Peptide sequence KWGRSQAARGKEKEKDGTTDSGIKLEPVPGLPGALPPPPAAEEEASANYF.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
RBM22
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against RBM22 and was validated on Western Blot and immunohistochemistry-p
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS & 2% Sucrose.
|
| Preservative |
No Preservative
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for RBM22 Antibody
- Cwc2
- FLJ10290
- fSAP47
- functional spliceosome-associated protein 47
- pre-mRNA-splicing factor RBM22
- RNA binding motif protein 22
- ZC3H16RNA-binding motif protein 22
- Zinc finger CCCH domain-containing protein 16
Background
RBM22 may be involved in pre-mRNA splicing.