PSMB5 Antibody Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LASVLERPLPVNQRGFFGLGGRADLLDLGPGSLSDGLSLAAPGWGVPEEPGIEMLHGTT
|
| Specificity |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
|
| Isotype |
IgG
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
PSMB5
|
| Purity |
Affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
||
| Application Notes |
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
|
||
| Control Peptide |
|
Reactivity Notes
Mouse 88%, Rat 88%
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
|
| Buffer |
PBS, pH 7.2, containing 40% glycerol
|
| Preservative |
0.02% Sodium Azide
|
| Purity |
Affinity purified
|
Alternate Names for PSMB5 Antibody
- LMPXproteasome beta 5 subunit
- Macropain epsilon chain
- MB1EC 3.4.25.1
- Multicatalytic endopeptidase complex epsilon chain
- proteasome (prosome, macropain) subunit, beta type, 5
- proteasome catalytic subunit 3
- Proteasome chain 6
- Proteasome epsilon chain
- proteasome subunit beta type-5
- Proteasome subunit MB1
- Proteasome subunit X
- proteasome subunit, beta type, 5
- PSX large multifunctional protease X
- XMGC104214