PSMB10/MECL1 Antibody Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: FRYQGHVGASLIVGGVDLTGPQLYGVHPHGSYSRLPFTALGSGQDAALAVLEDRFQPNMTLEAAQGLLVEAVT
|
| Specificity |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
|
| Predicted Species |
Rat (92%). Backed by our 100% Guarantee.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
PSMB10
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
||
| Application Notes |
This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH6 antigen retrieval is recommended.
|
||
| Control Peptide |
|
Reactivity Notes
Expected species cross reactivity based on sequence homology: Mouse (89%)
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
|
| Buffer |
PBS (pH 7.2) and 40% Glycerol
|
| Preservative |
0.02% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Alternate Names for PSMB10/MECL1 Antibody
- beta2i
- FLJ00366
- LMP10
- LMP10Proteasome subunit beta-2i
- Low molecular mass protein 10
- Macropain subunit MECl-1
- MECL1
- MECl-1
- MECL1EC 3.4.25.1
- MGC1665
- Multicatalytic endopeptidase complex subunit MECl-1
- proteasome (prosome, macropain) subunit, beta type, 10
- proteasome catalytic subunit 2i
- Proteasome MECl-1
- proteasome subunit beta 7i
- proteasome subunit beta type-10
- Proteasome subunit beta-2i
- proteasome subunit MECL1
- PSMB10