Product: TMB (dihydrochloride)
POP7 Antibody Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids:HGLGLAINRAINIALQLQAGSFGSLQVAANTSTVELVDELEPETDTREPLTRIRNNSAIHIRVFRVTPK
|
Specificity |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
|
Predicted Species |
Mouse (97%), Rat (99%). Backed by our 100% Guarantee.
|
Isotype |
IgG
|
Clonality |
Polyclonal
|
Host |
Rabbit
|
Gene |
POP7
|
Purity |
Immunogen affinity purified
|
Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
Dilutions |
|
||
Application Notes |
This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH6 antigen retrieval is recommended.
|
||
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
|
Buffer |
PBS (pH 7.2) and 40% Glycerol
|
Preservative |
0.02% Sodium Azide
|
Purity |
Immunogen affinity purified
|
Alternate Names for POP7 Antibody
- 0610037N12Rik
- EC 3.1.26.5
- hPOP7
- processing of precursor 7, ribonuclease P subunit (S. cerevisiae)
- processing of precursor 7, ribonuclease P subunit
- processing of precursor 7, ribonuclease P/MRP subunit (S. cerevisiae)
- ribonuclease P protein subunit p20
- Ribonucleases P/MRP protein subunit POP7 homolog
- RNaseP protein p20
- RPP20S. cerevisiae) homolog