Product: Chlormethine (hydrochloride)
PKA regulatory subunit I beta Antibody Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids:QQVLKDCIVHLCISKPERPMKFLREHFEKLEKEENRQILARQKSNSQSDSHDEEVSPT
|
Specificity |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
|
Isotype |
IgG
|
Clonality |
Polyclonal
|
Host |
Rabbit
|
Gene |
PRKAR1B
|
Purity |
Immunogen affinity purified
|
Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
Dilutions |
|
||
Application Notes |
For IHC-Paraffin HIER pH6 retrieval is recommended.
|
||
Control Peptide |
|
Reactivity Notes
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
|
Buffer |
PBS (pH 7.2) and 40% Glycerol
|
Preservative |
0.02% Sodium Azide
|
Purity |
Immunogen affinity purified
|
Alternate Names for PKA regulatory subunit I beta Antibody
- cAMP-dependent protein kinase type I-beta regulatory subunit
- PRKAR1
- protein kinase, cAMP-dependent, regulatory, type I, beta