PAIP1 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to PAIP1 (poly(A) binding protein interacting protein 1) The peptide sequence was selected from the C terminal of PAIP1 (NP_877590).Peptide sequence EPTFYTSDGVPFTAADPDYQEKYQELLEREDFFPDYEENGTDLSGAGDPY.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
PAIP1
|
| Purity |
Protein A purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Protein A purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for PAIP1 Antibody
- MGC12360
- PABC1-interacting protein 1
- PABP-interacting protein 1
- PAIP-1
- poly(A) binding protein interacting protein 1
- Poly(A)-binding protein-interacting protein 1
- polyadenylate binding protein-interacting protein 1
- polyadenylate-binding protein-interacting protein 1
Background
PAIP1 interacts with poly(A)-binding protein and with the cap-binding complex eIF4A. It is involved in translational initiation and protein biosynthesis. Overexpression of this gene in COS7 cells stimulates translation.The protein encoded by this gene interacts with poly(A)-binding protein and with the cap-binding complex eIF4A. It is involved in translational initiation and protein biosynthesis. Overexpression of this gene in COS7 cells stimulates translation. Alternative splicing occurs at this locus and three transcript variants encoding three distinct isoforms have been identified.