PAFAH1B3 Antibody Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids:KAIVQLVNERQPQARVVVLGLLPRGQHPNPLREKNRQVNELVRAALAGHPRAHFLDADPGFVHS
|
Specificity |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
|
Predicted Species |
Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
|
Isotype |
IgG
|
Clonality |
Polyclonal
|
Host |
Rabbit
|
Gene |
PAFAH1B3
|
Purity |
Immunogen affinity purified
|
Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
Dilutions |
|
||
Application Notes |
For IHC-Paraffin HIER pH6 retrieval is recommended.
|
||
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
|
Buffer |
PBS (pH 7.2) and 40% Glycerol
|
Preservative |
0.02% Sodium Azide
|
Purity |
Immunogen affinity purified
|
Alternate Names for PAFAH1B3 Antibody
- EC 3.1.1.47
- FLJ44990
- PAF acetylhydrolase 29 kDa subunit
- PAF-AH 29 kDa subunit
- PAFAH subunit gamma
- PAF-AH subunit gamma
- PAF-AH1b alpha 1 subunit
- PAFAHG
- platelet-activating factor acetylhydrolase 1b, catalytic subunit 3 (29kDa)
- platelet-activating factor acetylhydrolase IB subunit gamma
- platelet-activating factor acetylhydrolase, isoform Ib, gamma subunit (29kD)
- platelet-activating factor acetylhydrolase, isoform Ib, gamma subunit 29kDa
- platelet-activating factor acetylhydrolase, isoform Ib, subunit 3 (29kDa)