OSBPL3 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to OSBPL3(oxysterol binding protein-like 3) The peptide sequence was selected from the N terminal of OSBPL3 (NP_663160). Peptide sequence MMSDEKNLGVSQKLVSPSRSTSSCSSKQGSRQDSWEVVEGLRGEMNYTQE.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
OSBPL3
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
|
| Application Notes |
This is a rabbit polyclonal antibody against OSBPL3 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
|
|
| Theoretical MW |
98 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
| Publications |
|
Reactivity Notes
Mouse reactivity reported in scientific literature (PMID: 28094767).
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for OSBPL3 Antibody
- DKFZp667P1518
- KIAA0704ORP3ORP-3OSBP3
- MGC21526
- OSBP-related protein 3
- oxysterol binding protein-like 3
- oxysterol-binding protein 3
- oxysterol-binding protein-related protein 3
Background
The specific functin of this protein remains unknown.This gene encodes a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Most members contain an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like sterol-binding domain. Several transcript variants encoding different isoforms have been identified.