NUDT2 Antibody Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RELNYVARNKPKTVIYWLAEVKDYDVEIRLSHEHQAYRWLGLEEACQLAQFKEMKAALQEGHQFLCSIE
|
| Specificity |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
|
| Predicted Species |
Mouse (91%), Rat (91%). Backed by our 100% Guarantee.
|
| Isotype |
IgG
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
NUDT2
|
| Purity |
Affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
||
| Application Notes |
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
|
||
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
|
| Buffer |
PBS, pH 7.2, containing 40% glycerol
|
| Preservative |
0.02% Sodium Azide
|
| Purity |
Affinity purified
|
Alternate Names for NUDT2 Antibody
- Ap4A hydrolase 1
- Ap4A hydrolase
- Ap4Aase
- APAH1Diadenosine 5-5-P1
- bis(5-nucleosyl)-tetraphosphatase (asymmetrical)
- bis(5-nucleosyl)-tetraphosphatase [asymmetrical]
- diadenosine 5-5-P1
- Diadenosine tetraphosphatase
- EC 3.6.1.17
- MGC10404
- Nucleoside diphosphate-linked moiety X motif 2
- nudix (nucleoside diphosphate linked moiety X)-type motif 2
- Nudix motif 2
- P4-tetraphosphate asymmetrical hydrolase
- P4-tetraphosphate pyrophosphohydrolase