Myelin PLP Antibody (2D7) Summary
| Immunogen |
PLP1 (NP_000524 177 a.a. – 232 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YFNTWTTCQSIAFPSKTSASIGSLCADARMYGVLPWNAFPGKVCGSNLLSICKTAE
|
| Marker |
Oligodendrocyte Marker
|
| Specificity |
PLP1 – proteolipid protein 1 (Pelizaeus-Merzbacher disease, spastic paraplegia 2, uncomplicated) (2D7)
|
| Isotype |
IgG2a Kappa
|
| Clonality |
Monoclonal
|
| Host |
Mouse
|
| Gene |
PLP1
|
| Purity |
IgG purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
|
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS (pH 7.4)
|
| Preservative |
No Preservative
|
| Purity |
IgG purified
|
Notes
Quality control test: Antibody Reactive Against Recombinant Protein.
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Myelin PLP Antibody (2D7)
- DM-20
- HLD1
- Lipophilin
- major myelin proteolipid protein
- MMPL
- Myelin PLP
- myelin proteolipid protein
- PLP
- PLP/DM20
- PLP1
- PMD
- proteolipid protein 1
- spastic paraplegia 2, uncomplicated
- SPG2
Background
This gene encodes a transmembrane proteolipid protein that is the predominant myelin protein present in the central nervous system. It may play a role in the compaction, stabilization, and maintenance of myelin sheaths, as well as in oligodendrocyte development and axonal survival. Mutations in this gene cause X-linked Pelizaeus-Merzbacher disease and spastic paraplegia type 2. Alternatively spliced transcript variants encoding distinct isoforms or having different 5 UTRs, have been identified for this gene. [provided by RefSeq]