Methyltransferase like 5 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to METTL5(methyltransferase like 5) The peptide sequence was selected from the N terminal of METTL5.Peptide sequence IAACMLYTIHNTYDDIENKVVADLGCGCGVLSIGTAMLGAGLCVGFDIDE.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
METTL5
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against METTL5 and was validated on Western blot.
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for Methyltransferase like 5 Antibody
- EC 2.1.1.-
- FLJ10459
- HSPC133
- methyltransferase like 5
- methyltransferase-like protein 5
Background
METTL5 is a probable methyltransferase.