MOV10 Antibody Summary
Immunogen |
Synthetic peptides corresponding to MOV10(Mov10, Moloney leukemia virus 10, homolog (mouse)) The peptide sequence was selected from the C terminal of MOV10.Peptide sequence AKLDLQQGQNLLQGLSKLSPSTSGPHSHDYLPQEREGEGGLSLQVEPEWR.
|
Clonality |
Polyclonal
|
Host |
Rabbit
|
Gene |
MOV10
|
Purity |
Protein A purified
|
Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
Dilutions |
|
Application Notes |
This is a rabbit polyclonal antibody against MOV10 and was validated on Western Blot and immunohistochemistry-p
|
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
Buffer |
PBS and 2% Sucrose
|
Preservative |
0.09% Sodium Azide
|
Purity |
Protein A purified
|
Notes
Alternate Names for MOV10 Antibody
- DKFZp667O1423
- EC 3.6.1
- EC 3.6.4.13
- FLJ32791
- KIAA1631mouse) homolog
- Mov10, Moloney leukemia virus 10, homolog (mouse)