MKP-1/DUSP1 Antibody (4H7) Summary
| Immunogen |
DUSP1 (NP_004408 305 a.a. – 367 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LLQFESQVLAPHCSAEAGSPAMAVLDRGTSTTTVFNFPVSIPVHSTNSALSYLQSPITTSPSC
|
| Specificity |
DUSP1 – dual specificity phosphatase 1 (4H7)
|
| Isotype |
IgG1 Kappa
|
| Clonality |
Monoclonal
|
| Host |
Mouse
|
| Gene |
DUSP1
|
| Purity |
IgG purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
|
| Application Notes |
Antibody reactivity Against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. FACS usage was reported in scientific literature.
|
|
| Publications |
|
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS (pH 7.4)
|
| Preservative |
No Preservative
|
| Purity |
IgG purified
|
Notes
Quality control test: Antibody Reactive Against Recombinant Protein.
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for MKP-1/DUSP1 Antibody (4H7)
- CL100
- CL100MAP kinase phosphatase 1
- dual specificity phosphatase 1
- Dual specificity protein phosphatase hVH1
- DUSP1
- EC 3.1.3.16
- EC 3.1.3.48
- HVH1
- Mitogen-activated protein kinase phosphatase 1
- MKP1
- MKP-1
- MKP-1dual specificity protein phosphatase 1
- Protein-tyrosine phosphatase CL100
- PTPN10
- PTPN10serine/threonine specific protein phosphatase
- VH1
Background
The expression of DUSP1 gene is induced in human skin fibroblasts by oxidative/heat stress and growth factors. It specifies a protein with structural features similar to members of the non-receptor-type protein-tyrosine phosphatase family, and which has significant amino-acid sequence similarity to a Tyr/Ser-protein phosphatase encoded by the late gene H1 of vaccinia virus. The bacterially expressed and purified DUSP1 protein has intrinsic phosphatase activity, and specifically inactivates mitogen-activated protein (MAP) kinase in vitro by the concomitant dephosphorylation of both its phosphothreonine and phosphotyrosine residues. Furthermore, it suppresses the activation of MAP kinase by oncogenic ras in extracts of Xenopus oocytes. Thus, DUSP1 may play an important role in the human cellular response to environmental stress as well as in the negative regulation of cellular proliferation. [provided by RefSeq]