MDR3/ABCB4 Antibody Summary
Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: HSELMKKEGVYFKLVNMQTSGSQIQSEEFELNDEKAATRMAPNGWKSRLFRHSTQKNLKNSQMCQKSLDVETDGLEANVPPVS
|
Specificity |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
|
Isotype |
IgG
|
Clonality |
Polyclonal
|
Host |
Rabbit
|
Gene |
ABCB4
|
Purity |
Immunogen affinity purified
|
Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
Dilutions |
|
||
Application Notes |
This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH6 antigen retrieval is recommended.
|
||
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
|
Buffer |
PBS (pH 7.2) and 40% Glycerol
|
Preservative |
0.02% Sodium Azide
|
Purity |
Immunogen affinity purified
|
Alternate Names for MDR3/ABCB4 Antibody
- ABC21
- ABCB4
- ATP-binding cassette sub-family B member 4
- ATP-binding cassette, sub-family B (MDR/TAP), member 4
- EC 3.6.3
- EC 3.6.3.44
- GBD1
- MDR2
- MDR3
- MDR3MDR2/3
- multidrug resistance protein 3
- multiple drug resistance 3
- P glycoprotein 3/multiple drug resistance 3
- PFIC-3
- P-glycoprotein 3
- P-glycoprotein-3/multiple drug resistance-3
- PGY3
- PGY3GBD1