Katanin p60 Antibody Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids:RVHRSSAQNVHNDRGKAVRCREKKEQNKGREEKNKSPAAVTEPETNKFDSTGYDKDLVEALERDIISQNPNVRWDD
|
Specificity |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
|
Isotype |
IgG
|
Clonality |
Polyclonal
|
Host |
Rabbit
|
Gene |
KATNA1
|
Purity |
Immunogen affinity purified
|
Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
Dilutions |
|
||
Application Notes |
For IHC-Paraffin HIER pH6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
||
Theoretical MW |
56 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
||
Control Peptide |
|
Reactivity Notes
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
|
Buffer |
PBS (pH 7.2) and 40% Glycerol
|
Preservative |
0.02% Sodium Azide
|
Purity |
Immunogen affinity purified
|
Alternate Names for Katanin p60 Antibody
- EC 3.6.4.3
- katanin p60 (ATPase containing) subunit A 1
- katanin p60 (ATPase-containing) subunit A 1
- katanin p60 ATPase-containing subunit A1
- Katanin p60 subunit A1
- Katanin p60
- KATNA1
- p60 katanin