KNL-2 Antibody Summary
| Immunogen |
This antibody was made against a protein fragment from the N Terminus Region
|
| Epitope |
YTLRAPKSQNGEPITPIRFTRGHDNGGAKKVFIFEQTPVRKQGPIASSTPQQKQRLADGANNQIPPTQKSQDSVQAVQPPPPRPAARNAQFASDADLFAV
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
MIS18BP1
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
|
| Application Notes |
This antibody works in ELISA, Immunofluorescence. The concentration for this product is lot dependent. Check product vial for current lot concentration. Typically concentration ranges from 0.5 to 1.5 mg/ml.
|
|
| Publications |
|
Reactivity Notes
Caenorhabditis elegans
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
|
| Buffer |
20mM Potassium Phosphate (pH 7.0) and 0.15M NaCl
|
| Preservative |
No Preservative
|
| Purity |
Immunogen affinity purified
|
Notes
This product was created from the ModEncode Project, a part of the NHGRI, and is sold by SDIX and Novus Biologicals. These C. elegans antibodies were generated in the labs of Jason Lieb, Susan Strome, Julie Ahringer, Arshad Desai, and Abby Dernburg.
Alternate Names for KNL-2 Antibody
- C14orf106
- chromosome 14 open reading frame 106
- FLJ11186
- hsKNL-2
- KIAA1903HSA242977
- Kinetochore-associated protein KNL-2 homolog
- KNL2
- M18BP1
- MIS18 binding protein 1
- mis18-binding protein 1
- P243
- putative protein p243 which interacts with transcription factor Sp1
Background
C14orf106 is required for recruitment of CENPA to centromeres and normal chromosome segregation during mitosis.