KIAA0020 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to KIAA0020 (KIAA0020) The peptide sequence was selected from the N terminal of KIAA0020.Peptide sequence GKKGVKQFKNKQQGDKSPKNKFQPANKFNKKRKFQPDGRSDESAAKKPKW.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
KIAA0020
|
| Purity |
Protein A purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against KIAA0020 and was validated on Western Blot and immunohistochemistry-paraffin
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Protein A purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for KIAA0020 Antibody
- HBV X-transactivated gene 5 protein
- HLA-HA8MGC8749
- KIAA0020 protein
- KIAA0020
- Minor histocompatibility antigen HA-8
- PEN
- penguin homolog
- protein 5 transactivated by hepatitis B virus X antigen (HBxAg)
- PUF6
- XTP5HBV XAg-transactivated protein 5
Background
KIAA0020 contains 6 pumilio repeats and 1PUM-HD domain. The function remains unknown.