ICA1 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to ICA1(islet cell autoantigen 1, 69kDa) The peptide sequence was selected from the N terminal of ICA1.Peptide sequence SKAIVLYQKRICFLSQEENELGKFLRSQGFQDKTRAGKMMQATGKALCFS.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
ICA1
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against ICA1 and was validated on Western blot.
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for ICA1 Antibody
- diabetes mellitus type I autoantigen
- ICA1
- ICA69
- ICAp69
- ICAp69Islet cell autoantigen p69,69 kDa islet cell autoantigen
- islet cell autoantigen 1 (69kD)
- islet cell autoantigen 1 isoform
- islet cell autoantigen 1
- islet cell autoantigen 1, 69kDa
- p69
Background
ICA1 is a protein with an arfaptin homology domain that is found both in the cytosol and as membrane-bound form on the Golgi complex and immature secretory granules. This protein is believed to be an autoantigen in insulin-dependent diabetes mellitus and primary Sjogrens syndrome. This gene encodes a protein with an arfaptin homology domain that is found both in the cytosol and as membrane-bound form on the Golgi complex and immature secretory granules. This protein is believed to be an autoantigen in insulin-dependent diabetes mellitus and primary Sjogrens syndrome. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized.