Product: (-)-Cevimeline (hydrochloride hemihydrate)
Hsp70 interacting protein HIP Antibody Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids:AIEINPDSAQPYKWRGKAHRLLGHWEEAAHDLALACKLDYDEDASAMLKEVQPRAQKIAEHRRKYER
|
| Specificity |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
|
| Isotype |
IgG
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
ST13
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
For IHC-Paraffin HIER pH6 retrieval is recommended.
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
|
| Buffer |
PBS (pH 7.2) and 40% Glycerol
|
| Preservative |
0.02% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Alternate Names for Hsp70 interacting protein HIP Antibody
- AAG2
- aging-associated protein 2
- FAM10A1FAM10A4
- heat shock 70kD protein binding protein
- Hip
- HIPFLJ27260
- HOP
- hsc70-interacting protein
- Hsp70-interacting protein
- HSPABP1
- P48MGC129952
- PRO0786
- Progesterone receptor-associated p48 protein
- Protein FAM10A1
- Putative tumor suppressor ST13
- Renal carcinoma antigen NY-REN-33
- SNC6HSPABP
- suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein)
- suppression of tumorigenicity 13 (colon carcinoma) (Hsp70-interacting protein)
- Suppression of tumorigenicity 13 protein