Product: Cyproheptadine (hydrochloride sesquihydrate)
HSD17B6 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to HSD17B6(hydroxysteroid (17-beta) dehydrogenase 6 homolog (mouse)) The peptide sequence was selected from the N terminal of HSD17B6 (NP_003716).Peptide sequence MWLYLAAFVGLYYLLHWYRERQVVSHLQDKYVFITGCDSGFGNLLARQLD.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
HSD17B6
|
| Purity |
Protein A purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
|
| Application Notes |
This is a rabbit polyclonal antibody against HSD17B6 and was validated on Western Blot and immunohistochemistry-p
The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
| Theoretical MW |
35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
| Publications |
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Protein A purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for HSD17B6 Antibody
- 17-beta-HSD 6
- 17-beta-HSD6
- 17-beta-hydroxysteroid dehydrogenase type 6
- 3(alpha->beta)-hydroxysteroid epimerase
- 3-alpha->beta-HSE
- EC 1.1.1
- EC 1.1.1.105
- EC 1.1.1.62
- EC 1.1.1.63
- HSE3-hydroxysteroid epimerase
- hydroxysteroid (17-beta) dehydrogenase 6 homolog (mouse)
- hydroxysteroid (17-beta) dehydrogenase 6
- NAD+ -dependent 3 alpha-hydroxysteroid dehydrogenase 3-hydroxysteroid epimerase
- Oxidative 3-alpha hydroxysteroid dehydrogenase
- oxidative 3-alpha-hydroxysteroid-dehydrogenase
- oxidoreductase
- retinol dehydrogenase
- RODH3(alpha->beta)-hydroxysteroid epimerasel
- SDR9C6
- short chain dehydrogenase/reductase family 9C, member 6,3-alpha->beta-hydroxysteroid epimerase
Background
HSD17B6 has both oxidoreductase and epimerase activities and is involved in androgen catabolism. The oxidoreductase activity can convert 3 alpha-adiol to dihydrotestosterone, while the epimerase activity can convert androsterone to epi-androsterone. Both reactions use NAD+ as the preferred cofactor. HSD17B6 is a member of the retinol dehydrogenase family.The protein encoded by this gene has both oxidoreductase and epimerase activities and is involved in androgen catabolism. The oxidoreductase activity can convert 3 alpha-adiol to dihydrotestosterone, while the epimerase activity can convert androsterone to epi-androsterone. Both reactions use NAD+ as the preferred cofactor. This gene is a member of the retinol dehydrogenase family. Transcript variants utilizing alternative polyadenylation signals exist.