HIF-3 alpha Antibody Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids:SPDLRRLLGPILDGASVAATPSTPLATRHPQSPLSADLPDELPVGTENVHRLFTSGKDTEAVETDLDIAQDADALD
|
| Specificity |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
|
| Isotype |
IgG
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
HIF3A
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
||
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. IF fixation/permeabilization: PFA/Triton X-100.
|
||
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
|
| Buffer |
PBS (pH 7.2) and 40% Glycerol
|
| Preservative |
0.02% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Alternate Names for HIF-3 alpha Antibody
- Basic-helix-loop-helix-PAS protein MOP7
- BHLHE17
- bHLHe17HIF-3A2
- Class E basic helix-loop-helix protein 17
- HIF-3A4
- HIF-3-alpha
- HIF3-alpha
- hypoxia inducible factor 3, alpha subunit
- hypoxia-inducible factor 3-alpha
- hypoxia-inducible factor-3 alpha 4
- Inhibitory PAS domain protein
- IPASHIF3-alpha-1
- Member of PAS protein 7
- MOP7PAS domain-containing protein 7
- PASD7HIF-3A