Fucosyltransferase 2/FUT2 Antibody Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids:QRLAKIQAMWELPVQIPVLASTSKALGPSQLRGMWTINAIGRLGNQMGEYATLYALAKMNGRPAFIPAQMHSTL
|
Specificity |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
|
Isotype |
IgG
|
Clonality |
Polyclonal
|
Host |
Rabbit
|
Gene |
FUT2
|
Purity |
Immunogen affinity purified
|
Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
Dilutions |
|
||
Application Notes |
For IHC-Paraffin HIER pH6 retrieval is recommended. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
|
||
Theoretical MW |
39 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
||
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
|
Buffer |
PBS (pH 7.2) and 40% Glycerol
|
Preservative |
0.02% Sodium Azide
|
Purity |
Immunogen affinity purified
|
Alternate Names for Fucosyltransferase 2/FUT2 Antibody
- alpha (1,2) fucosyltransferase
- Alpha(1,2)FT 2
- alpha(1,2)FT2
- B12QTL1
- EC 2.4.1.69
- fucosyltransferase 2 (secretor status included)
- Fucosyltransferase 2
- FUT2
- galactoside 2-alpha-L-fucosyltransferase 2
- GDP-L-fucose:beta-D-galactoside 2-alpha-L-fucosyltransferase 2
- Se
- Se2
- SEC2
- SEC2SE
- Secretor blood group alpha-2-fucosyltransferase
- Secretor factor
- SEJ