Product: EX-527 (R-enantiomer)
FUSIP1 Antibody Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: QPKKEMKAKSRSRSASHTKTRGTSKTDSKTHYKSGSRYEKESRKKEPPRSKSQS
|
| Specificity |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
|
| Predicted Species |
Mouse (100%). Backed by our 100% Guarantee.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
SRSF10
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
For IHC-Paraffin HIER pH6 retrieval is recommended.
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
|
| Buffer |
PBS (pH 7.2) and 40% Glycerol
|
| Preservative |
0.02% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Alternate Names for FUSIP1 Antibody
- 40 kDa SR-repressor protein
- FLJ43846
- FUS interacting protein (serine-arginine rich) 1
- FUS-interacting protein (serine-arginine rich) 2
- FUS-interacting serine-arginine-rich protein 1
- FUSIP1DKFZp686H0644
- FUSIP2
- neural-salient SR protein
- NSSR
- serine/arginine-rich splicing factor 10
- serine-arginine repressor protein (40 kDa)
- SFRS13
- SFRS13A
- Splicing factor SRp38
- splicing factor, arginine/serine-rich 13
- Splicing factor, arginine/serine-rich 13ATLS-associated protein with Ser-Arg repeats
- SR splicing factor 10
- SRp38
- SRrp40TLS-associated protein with SR repeats
- TASR1TLS-associated SR protein
- TASR2FUS interacting protein (serine/arginine-rich) 1
- TASRFLJ30749
- TLS-associated protein TASR
- TLS-associated serine-arginine protein 1
- TLS-associated serine-arginine protein 2
- TLS-associated serine-arginine protein