FKBP52/FKBP4 Antibody Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DFELARADFQKVLQLYPNNKAAKTQLAVCQQRIRRQLAREKKLYANMFERLAEEENKAKAEASSGDHPTDTEMKEEQKSNTAGSQSQVE
|
| Specificity |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
|
| Isotype |
IgG
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
FKBP4
|
| Purity |
Affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
||
| Application Notes |
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
|
||
| Control Peptide |
|
Reactivity Notes
Mouse 81%, Rat 81%
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
|
| Buffer |
PBS, pH 7.2, containing 40% glycerol
|
| Preservative |
0.02% Sodium Azide
|
| Purity |
Affinity purified
|
Alternate Names for FKBP52/FKBP4 Antibody
- 51 kDa FK506-binding protein
- 52 kDa FKBP
- 59 kDa immunophilin
- EC 5.2.1.8
- FK506 binding protein 4, 59kDa
- FK506-binding protein 4 (59kD)
- FK506-binding protein 4
- FKBP4
- FKBP-4
- FKBP51
- FKBP52
- FKBP-52
- FKBP52T-cell FK506-binding protein, 59kD
- FKBP59
- FKBP5952 kDa FK506-binding protein
- HBI
- HSP binding immunophilin
- Hsp56
- HSP-binding immunophilin
- Immunophilin FKBP52
- p52
- p59
- peptidyl-prolyl cis-trans isomerase FKBP4
- peptidylprolyl cis-trans isomerase
- PPIase FKBP4
- PPIase
- rotamase