FKBP25 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to FKBP3(FK506 binding protein 3, 25kDa) The peptide sequence was selected from the C terminal of FKBP3.Peptide sequence EALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLTFEVELVDID.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
FKBP3
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against FKBP3 and was validated on Western blot.
The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Theoretical MW |
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for FKBP25 Antibody
- EC 5.2.1.8,25 kDa FK506-binding protein
- FK506 binding protein 3, 25kDa
- FK506-binding protein 3 (25kD)
- FK506-binding protein 3
- FKBP25
- FKBP25,25 kDa FKBP
- FKBP3
- FKBP-3
- Immunophilin FKBP25
- peptidyl-prolyl cis-trans isomerase FKBP3
- PPIase FKBP3
- PPIase
- rapamycin binding protein
- Rapamycin-selective 25 kDa immunophilin
- rotamase
- T-cell
Background
FKBP3 is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. FKBP3 is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin, as well as histone deacetylases, the transcription factor YY1, casein kinase II, and nucleolin. It has a higher affinity for rapamycin than for FK506 and thus may be an important target molecule for immunosuppression by rapamycin.The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It has a higher affinity for rapamycin than for FK506 and thus may be an important target molecule for immunosuppression by rapamycin.