EPC1 Antibody Summary
| Immunogen |
This antibody was made against a protein fragment from the Middle Region
|
| Epitope |
SECSVGNRAVTQMPSGMEKEEEQEKHLQEAIAAQQASTSGIQLNHVIPTPKVDRVEDQRYHSTYHNKNKMHRSKYIKVHAWQALERDEPEYDYDTEDEAW
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
EPC1
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
|
| Application Notes |
This antibody is useful in Chromatin Immunoprecipitation, ELISA and Western Blot.
|
|
| Publications |
|
Reactivity Notes
Caenorhabditis elegans
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
|
| Buffer |
20mM Potassium Phosphate (pH 7.0) and 0.15M NaCl
|
| Preservative |
No Preservative
|
| Purity |
Immunogen affinity purified
|
Notes
This product was created from the ModEncode Project, a part of the NHGRI, and is sold by SDIX and Novus Biologicals. These C. elegans antibodies were generated in the labs of Jason Lieb, Susan Strome, Julie Ahringer, Arshad Desai, and Abby Dernburg.
Alternate Names for EPC1 Antibody
- DKFZp781P2312
- enhancer of polycomb 1
- enhancer of polycomb homolog 1 (Drosophila)
- enhancer of polycomb homolog 1
- Epl1
Background
EPC1 is a component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome – DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. NuA4 may also play a direct role in DNA repair when directly recruited to sites of DNA damage.