Product: Denatonium (benzoate)
Dystroglycan Antibody Summary
| Immunogen |
Synthetic peptides corresponding to DAG1(dystroglycan 1 (dystrophin-associated glycoprotein 1)) The peptide sequence was selected from the middle region of DAG1.Peptide sequence AIGPPTTAIQEPPSRIVPTPTSPAIAPPTETMAPPVRDPVPGKPTVTIRT.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
DAG1
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against DAG1 and was validated on Western blot.
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for Dystroglycan Antibody
- A3a
- AGRNR
- DAG1
- Dag-1
- DAG156DAG
- dystroglycan 1 (dystrophin-associated glycoprotein 1)
- Dystroglycan
- Dystrophin-associated glycoprotein 1
Background
Dystroglycan is a laminin binding component of the dystrophin-glycoprotein complex which provides a linkage between the subsarcolemmal cytoskeleton and the extracellular matrix. Dystroglycan 1 is a candidate gene for the site of the mutation in autosomal