Deleted in azoospermia 4 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to DAZ4 (deleted in azoospermia 4) The peptide sequence was selected from the N terminal of DAZ4.Peptide sequence MSAANPETPNSTISREASTQSSSAAASQGWVLPEGKIVPNTVFVGGIDAR.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
DAZ4
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against DAZ4 and was validated on Western Blot and immunohistochemistry-paraffin
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS & 2% Sucrose.
|
| Preservative |
No Preservative
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for Deleted in azoospermia 4 Antibody
- deleted in azoospermia 4
- deleted in azoospermia protein 4
- pDP1680
- pDP1681
Background
This gene is a member of the DAZ gene family and is a candidate for the human Y-chromosomal azoospermia factor (AZF). This RNA-binding protein is important for spermatogenesis.