Product: Metaraminol (tartrate)
DC-SIGNR/CD299/CLEC4M Antibody Summary
| Immunogen |
Synthetic peptides corresponding to CLEC4M(C-type lectin domain family 4, member M) The peptide sequence was selected from the N terminal of CLEC4M.Peptide sequence LVLQLLSFMLLAGVLVAILVQVSKVPSSLSQEQSEQDAIYQNLTQLKAAV.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
CLEC4M
|
| Purity |
Protein A purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
|
| Application Notes |
This is a rabbit polyclonal antibody against CLEC4M and was validated on Western Blot and immunohistochemistry-paraffin
|
|
| Publications |
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Protein A purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for DC-SIGNR/CD299/CLEC4M Antibody
- CD209L
- CD209L1
- CD209Ldendritic cell-specific ICAM-3-grabbing nonintegrin 2
- CD299 antigenMGC129964
- CD299
- CLEC4M
- C-type lectin domain family 4, member M
- DC-SIGN2
- DC-SIGN2CD209 antigen-like protein 1
- DCSIGNR
- DC-SIGNR
- DC-SIGNRDC-SIGN-related protein
- DCSIGNRMGC47866
- Dendritic cell-specific ICAM-3-grabbing non-integrin 2
- HP10347
- liver/lymph node-specific ICAM-3 grabbing non-integrin
- Liver/lymph node-specific ICAM-3-grabbing non-integrin
- LSIGN
- L-SIGN
- LSIGNC-type lectin domain family 4 member M
- mannose binding C-type lectin DC-SIGNR
Background
CLEC4M is a type II integral membrane protein that is 77% identical to CD209 antigen, a HIV gp120-binding protein. This protein, like CD209, efficiently binds both intercellular adhesion molecule 3 (ICAM3) and HIV-1 gp120, and enhances HIV-1 infection of T cells.Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.This gene encodes a type II integral membrane protein that is 77% identical to CD209 antigen, a HIV gp120-binding protein. This protein, like CD209, efficiently binds both intercellular adhesion molecule 3 (ICAM3) and HIV-1 gp120, and enhances HIV-1 infection of T cells. This gene is mapped to 19p13.3, in a cluster with the CD209 and CD23/FCER2 genes. Multiple alternatively spliced transcript variants have been found for this gene, but the biological validity of some variants has not been determined.