DCI Antibody Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids:FGSQRVLVEPDAGAGVAVMKFKNPPVNSLSLEFLTELVISLEKLENDKSFRGVILTSDRPGVFSAGLDLTEMCGRS
|
Specificity |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
|
Isotype |
IgG
|
Clonality |
Polyclonal
|
Host |
Rabbit
|
Gene |
ECI1
|
Purity |
Immunogen affinity purified
|
Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
Dilutions |
|
||
Application Notes |
This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH6 antigen retrieval is recommended.
|
||
Control Peptide |
|
Reactivity Notes
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
|
Buffer |
PBS (pH 7.2) and 40% Glycerol
|
Preservative |
0.02% Sodium Azide
|
Purity |
Immunogen affinity purified
|
Alternate Names for DCI Antibody
- acetylene-allene isomerase
- D2-enoyl-CoA isomerase
- D3
- DCI3,2-trans-enoyl-CoA isomerase3,2 trans-enoyl-CoA isomerase
- Delta(2)-enoyl-CoA isomerase
- Delta(3)
- delta3, delta2-enoyl-CoA isomerase
- dodecenoyl-CoA delta isomerase (3,2 trans-enoyl-CoA isomerase)
- dodecenoyl-CoA isomerase3,2-trans-enoyl-CoA isomerase, mitochondrial
- dodecenoyl-Coenzyme A delta isomerase (3,2 trans-enoyl-Coenzyme A isomerase)
- EC 5.3.3.8
- enoyl-CoA delta isomerase 13,2 trans-enoyl-Coenzyme A isomerase