DACT3/Dapper 3 Antibody Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids:ALEEQLEALPGLVWDLGQQLGDLSLESGGLEQESGRSSGFYEDPSSTGGPDSPPSTFCGDSGFSGSSSYGRLGPSEP
|
Specificity |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
|
Predicted Species |
Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
|
Isotype |
IgG
|
Clonality |
Polyclonal
|
Host |
Rabbit
|
Gene |
DACT3
|
Purity |
Immunogen affinity purified
|
Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
Dilutions |
|
||
Application Notes |
For HIER pH6 retrieval is recommended.
|
||
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
|
Buffer |
PBS (pH 7.2) and 40% Glycerol
|
Preservative |
0.02% Sodium Azide
|
Purity |
Immunogen affinity purified
|
Alternate Names for DACT3/Dapper 3 Antibody
- Antagonist of beta-catenin Dapper homolog 3
- arginine rich region 1
- Arginine-rich region 1 protein
- DACT3
- Dapper 3
- dapper homolog 3
- dapper, antagonist of beta-catenin, homolog 3 (Xenopus laevis)
- MGC15476
- RRR1