Cytochrome P450 1A1 Antibody Summary
Immunogen |
Synthetic peptides corresponding to CYP1A1(cytochrome P450, family 1, subfamily A, polypeptide 1) The peptide sequence was selected from the middle region of CYP1A1 (NP_000490).Peptide sequence QLSDEKIINIVLDLFGAGFDTVTTAISWSLMYLVMNPRVQRKIQEELDTV.
|
Clonality |
Polyclonal
|
Host |
Rabbit
|
Gene |
CYP1A1
|
Purity |
Immunogen affinity purified
|
Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
Dilutions |
|
|
Application Notes |
This is a rabbit polyclonal antibody against CYP1A1 and was validated on Western blot.
The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
Theoretical MW |
58 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
Publications |
|
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
Buffer |
PBS & 2% Sucrose.
|
Preservative |
No Preservative
|
Purity |
Immunogen affinity purified
|
Notes
Alternate Names for Cytochrome P450 1A1 Antibody
- AHH
- AHRR
- aryl hydrocarbon hydroxylase
- CP11
- CYP1
- CYPIA1
- cytochrome P1-450, dioxin-inducible
- cytochrome P450 1A1
- Cytochrome P450 form 6
- cytochrome P450, family 1, subfamily A, polypeptide 1
- Cytochrome P450-C
- Cytochrome P450-P1
- EC 1.14.14.1
- flavoprotein-linked monooxygenase
- P1-450
- P450-C
- P450DX
- subfamily I (aromatic compound-inducible), polypeptide 1
- xenobiotic monooxygenase