Product: Sapropterin (dihydrochloride)
Chitinase 3-like 1 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to CHI3L1(chitinase 3-like 1 (cartilage glycoprotein-39)) The peptide sequence was selected from the middle region of CHI3L1. Peptide sequence LDFISIMTYDFHGAWRGTTGHHSPLFRGQEDASPDRFSNTDYAVGYMLRL.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
CHI3L1
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against CHI3L1 and was validated on Western blot.
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for Chitinase 3-like 1 Antibody
- AW208766
- Brp39
- CHI3L1
- Chitinase 3 like 1
- Chitinase 3-like 1
- gp39
- HCgp39
- YKL-40
Background
CHI3L1 may play an important role in the capacity of cells to respond to and cope with changes in their environment. CHI3L1 may play a role in tissue remodeling and defense against pathogens. It belongs to the glycosyl hydrolase 18 family. CHI3L1 may play an important role in the capacity of cells to respond to and cope with changes in their environment.