Product: Naltrexone metabolite 6β-Naltrexol (hydrochloride)
CHMP5 Antibody Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids:KAYKQVKIDQIEDLQDQLEDMMEDANEIQEALSRSYGTPELDEDDLEAELD
|
| Specificity |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
|
| Isotype |
IgG
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
CHMP5
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
For IHC-Paraffin HIER pH6 retrieval is recommended.
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
|
| Buffer |
PBS (pH 7.2) and 40% Glycerol
|
| Preservative |
0.02% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Alternate Names for CHMP5 Antibody
- apoptosis-related protein PNAS-2
- C9orf83
- charged multivesicular body protein 5
- chromatin modifying protein 5
- Chromatin-modifying protein 5
- chromosome 9 open reading frame 83
- HSPC177
- hVps60
- PNAS-2
- SNF7 domain containing 2
- SNF7 domain-containing protein 2
- SNF7DC2
- Vacuolar protein sorting-associated protein 60
- Vps60CGI-34