ATP6V1D Antibody Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids:VNKAQVKIRAKKDNVAGVTLPVFEHYHEGTDSYELTGLARGGEQLAKLKRNYAKAVELLVELASLQTSFVTLDEAIKIT
|
| Specificity |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
|
| Predicted Species |
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
|
| Isotype |
IgG
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
ATP6V1D
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
For IHC-Paraffin HIER pH6 retrieval is recommended.
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
|
| Buffer |
PBS (pH 7.2) and 40% Glycerol
|
| Preservative |
0.02% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Alternate Names for ATP6V1D Antibody
- ATP6M
- ATPase, H+ transporting lysosomal, member M
- ATPase, H+ transporting, lysosomal (vacuolar proton pump)
- ATPase, H+ transporting, lysosomal 34kDa, V1 subunit D
- H(+)-transporting two-sector ATPase, subunit M
- vacuolar ATP synthase subunit D
- vacuolar H-ATPase subunit D
- vacuolar proton pump D subunit
- vacuolar proton pump delta polypeptide
- Vacuolar proton pump subunit D
- vacuolar proton-ATPase subunit D
- VATDV-ATPase D subunit
- V-ATPase 28 kDa accessory protein
- V-ATPase subunit D
- VMA8
- V-type proton ATPase subunit D