Product: Ivacaftor (benzenesulfonate)
ACSM1 Antibody Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids:HHLPQFDTKVIIQTLLKYPINHFWGVSSIYRMILQQDFTSIRFPALEHCYTGGEVVLPKDQEEWKRRTG
|
Specificity |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
|
Isotype |
IgG
|
Clonality |
Polyclonal
|
Host |
Rabbit
|
Gene |
ACSM1
|
Purity |
Immunogen affinity purified
|
Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
Dilutions |
|
||
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval method is recommended.
|
||
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
|
Buffer |
PBS (pH 7.2) and 40% Glycerol
|
Preservative |
0.02% Sodium Azide
|
Purity |
Immunogen affinity purified
|
Alternate Names for ACSM1 Antibody
- acyl-CoA synthetase medium-chain family member 1EC 6.2.1.2
- acyl-coenzyme A synthetase ACSM1, mitochondrial
- BUCS1
- Butyrate CoA ligase
- Butyrate–CoA ligase 1
- butyryl Coenzyme A synthetase 1
- Butyryl-coenzyme A synthetase 1
- EC 6.2.1
- LAE
- Lipoate-activating enzyme
- MACS1MGC150532
- medium-chain acyl-CoA synthetase
- Middle-chain acyl-CoA synthetase 1