ABI2 Antibody Summary
Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PSSTAPDAAAGGAQTLADGFTSPTPPVVSSTPPTGHPVQFYSMNRPASRHT
|
Specificity |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
|
Predicted Species |
Mouse (94%). Backed by our 100% Guarantee.
|
Isotype |
IgG
|
Clonality |
Polyclonal
|
Host |
Rabbit
|
Gene |
ABI2
|
Purity |
Affinity purified
|
Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
Dilutions |
|
Application Notes |
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
|
Buffer |
PBS, pH 7.2, containing 40% glycerol
|
Preservative |
0.02% Sodium Azide
|
Purity |
Affinity purified
|
Alternate Names for ABI2 Antibody
- Abelson interactor 2
- Abi-2
- ABI2B
- abl binding protein 3
- abl interactor 2
- Abl-binding protein 3
- AblBP3ABI-2
- abl-interacting protein 1 (SH3-containing protein)
- abl-interactor 2
- abl-interactor protein 2b
- AIP-1
- arg protein tyrosine kinase-binding protein
- Arg-binding protein 1
- argBP1
- argBPIA
- argBPIB
- SSH3BP2